SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG16379 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG16379
Domain Number 1 Region: 162-202,263-342
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-23
Family Voltage-gated potassium channels 0.0069
Further Details:      
 
Domain Number 2 Region: 373-455
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-20
Family Voltage-gated potassium channels 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG16379   Protein: CBP33803   Gene: WBGene00036335
Sequence length 775
Comment CBP33803 WBGene00036335 locus:Cbr-twk-22 status:Predicted UniProt:A8XNK2
Sequence
MNITEVPTVILHSPDTDSVISEDDSCYYFDGSVERLPLRNPEYSDERSMQRRNPIRRQRT
VLDEEQTKDAMKLLQKYVKKKYAGSAFLNESHDEQAATPVDQSAGQFSRNQTPHERLSAM
FNASPSGAFSDYMPAVSPDRDPAFRSELFKPRERESWGSWFFRVIKFLYQFLGLQYVMLA
LVILGYACIGGYMFQALEHDQQQLDLEMEQQVKIAESTLLAENLMDYIKKWNCGQSNEKK
CLELIMKAFVERTEKVEKSIRGDGWRWDFWNSVFFSATIFTTIGYGNLTCKTNIGRIATI
IYGLIGIPLMLFVLKVFGEFSIGWVKKISLFLKRCMKRCYRRALKRSNTIESVASHEMAD
DGSDDTEEEEGITTFPVKWALFIVFSFMVICSFIVSFWEKWDFLTAFYFFFVSLSTIGFG
DVIPEHPRTACGLFILYFVGLALFSMVYAILQERVENKYMWALELIDQEYQDKLENVELD
KEEQSEYGPPGAAGSGWGNAIGQLHSQNLIKWRNQQGKSMDNMPDRPISERRFSVFTPGE
PPHAAPPVLGTFMFHNMSMKKKLIARSESILNQQNPKRPSTLFPSNEMLSNSANSSRGSP
WPQAVDMNQPKEPIALGKSLGISAPNLANTGNRSPSGALSVITEASDEDTRHFKKHRKPL
AKTMATSDTPSNPGTQFFFCFFLSIRFLFLIKSQNYISTFASFLFQCSAESLDQEMDELQ
LEFPHQSITPKPYRDPHQIQTSKFRKQDETVASRAERMPLSPREPLEEEDEETEQ
Download sequence
Identical sequences A8XNK2
6238.CBG16379 CBG16379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]