SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17283 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17283
Domain Number 1 Region: 524-632
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-24
Family Voltage-gated potassium channels 0.0031
Further Details:      
 
Domain Number 2 Region: 196-228,434-487
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-17
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17283   Protein: CBP29439   Gene: WBGene00036960
Sequence length 944
Comment CBP29439 WBGene00036960 locus:Cbr-twk-44 status:Predicted UniProt:A8XQR6
Sequence
MQNCDYCVKVLQCVYGQLRKSVRSKRLLGSKLTHTCKRYPEKRLLCLFDKCCLIYKKFQY
KRSCLKFSKAHLLTIYNDMQPEKYDPRRICTEVQRVSDITSGKKKQVTFSVPDGNAPAPP
IILVEDSEMNGPASQLLNNYPIVRRDTIVDENAMQHLLLHESIWSHAFKKKRKRASSKNR
PSKLKRFVSLLQIIYDKSRVHYIVPIVLLIAYSVLGGLIFWSIERPNEEIMLADKRNYIA
ALTDDLVEVLLQIHNRLIDFNRAYANNTYLLMLHYRGYRKFALNQIHKSVYWYTLSTFYL
TEHEMHKVVALRPKNPEQLWKRHFESNFGRIRALKNYTEQLCLRCWELGVEGANLGWTRY
NYSLMVNQSVEEYNNSVGLGHVLTPVWTFWNAMFLAEHKVCCIMLSIQRIFGLQTFPRNI
FKLKFQIFRHFLKTAGPFFSVTTYTTIGYGNITAKTKLGKLAAMVYAVIGIPLVLMILHK
SGRLFLMGLEHVWDFILRLVALNFSLIDFNVSRITDSFCVGSGTKRVRNTSEDRISEMPL
ILAIGVAFGWMFLCAAIFLRFEKDWDYFKSFYFFFCSLTTIGYGDVTPTNSEDMFIIFGL
IIIGLSLVSMCINVIQLKLEKLFEELLLTLMEELNADPDGTHLKAGTIGAREMWRAWKKR
RGKLGDGLEKAKGARQAANKASENFVKKIFQMLPFSRKRERQHLIAELQKKLQRKEKSTQ
TDFGYPHCEEAYTETSDVDSCVTDFRNSVISDKCKMIDEVVGKLRLFSAHHHLLLIPDGP
ICGPSRCESRPVVALAEASLCSSSSVNPSSYPSSHRPSSTIPSSSPGSRASAPSAASSAK
SAPAASPSRQPPFVDFDPSRRWTFVATNRNQRGYPRGLVVPYMYTRPMSSVVHTTEVRRL
IAELDVRLQDCRSLATPTNSIRGTVSERSFSRSVISDSSIPEEL
Download sequence
Identical sequences A8XQR6
CBG17283 6238.CBG17283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]