SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17497 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17497
Domain Number 1 Region: 31-58,170-243
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-21
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 300-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-18
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17497   Protein: CBP26016   Gene: WBGene00037104
Sequence length 609
Comment CBP26016 WBGene00037104 locus:Cbr-twk-43 status:Predicted UniProt:A8XRB6
Sequence
MKEFVTINELEEVCEMGTFKDRFEKFKPYLLNAGIVLFVGIYVYAGALLIQYIERIPAKV
EESFRLRRNIKDDMPIIPLDRSKECVLHALRKMAHMAKGNCSHLHVCLKFNLSSLRSDFQ
TNVNLLDECYSSDLQKIKAIYDSHIPEGSTEPEQEPKSAVALKKFEVVDGFEQWTKTDAI
LFCFTVITTIGYGNVAPQSFWGRVFVIIYGTIGIPTAMMAIANVGKFLATLLKSWTRPFL
LLCRKMRKKMNKKDQNGNEVKETQRLMESSKKKAKKIEDDISSHDDEEQEEEIEESDVTE
TIVLFLAFLIYIIAGSFLMSYYEEGMTFGLAIYFNFVTLTTIGLGDLVPQSTDWLFVTLV
YCAIGLALTTIAIEIAADTLKKLHYFGRKLDNVHNVQIWFGGQKLSMKALVKNLGDQLNV
PVEDLENLDLAKFVDDAIKVEAGELTTLRNDRAWMNSNYWRAIESGSMHYVDDDDLVTLQ
SNLSCGSQQMLIRVPYSRSSDSRMITVNHEPLTEMSDENYRISSANEEYETVDTQFQDIE
AAITDRPHVSQNEGARKTSQCIELQKLLKALNDLNNEVVSQDGRWSEEARRRYLEYQRIW
SRFRTPKNH
Download sequence
Identical sequences A8XRB6
6238.CBG17497 CBG17497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]