SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17903 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17903
Domain Number 1 Region: 38-166
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.71e-18
Family Nuclear receptor ligand-binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 3-41
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000346
Family Nuclear receptor 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17903   Protein: CBP10725   Gene: WBGene00037414
Sequence length 170
Comment CBP10725 WBGene00037414 status:Predicted UniProt:A8XS25
Sequence
MSSCEVCGQAGHGMHFGVNTCRACAAFFRRAAESKWDRMKCLSRFFLDGMRGLDLLHLID
EIQSLDLTETELTFMLAHLCFQYVASRYGGKMSEVMEQFLGELSNDLHEYYTKDRMMIRY
SGRLMKLLRINKEILENIRLYRGRAEVAKVFDVFHLDFSHPEMFRDTGLM
Download sequence
Identical sequences A8XS25
6238.CBG17903 XP_002647713.1.8413 CBG17903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]