SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG18237 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG18237
Domain Number 1 Region: 3-40,111-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-28
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Domain Number 2 Region: 211-313
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-26
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG18237   Protein: CBP04292   Gene: WBGene00037690
Sequence length 393
Comment CBP04292 WBGene00037690 locus:Cbr-twk-40 status:Predicted UniProt:A8XS78
Sequence
MATWKSYARIILAHVSLIVLSVVYVGFGAFLFYQLEQPNEVEVRARNIERFNIHKRQMID
HLWEMRSSGIGQHVVEDMAVKYVDNVTRILFEAFDTHCIGAKHLRPGGEDEDYNWTYMTA
LFFTTTLLTTIGYGNLTPVTGRGKFLCILYALFGVPLILITVADIGKFLSENIVQLYTWY
RKLREKCSKQKYSVISNKDDKNKEGDLNLDHLENYISIPIFLIVAILLSYITFGAVVLSM
WEGWDFFSGFYFSFITMTTVGFGDIVPLKREYYILDLCYIIIGLSITTMCIDLVGIQYIR
KMHYFGRAIKDARFALVNVGGKMVHVPDLMRYASVLQQKYGQKKTHDTIIVKGAYAPKDL
SKIRFIDFGALASMESWQSLWSILTGRTQEVHV
Download sequence
Identical sequences A8XS78
CBG18237 XP_002642251.1.8413 6238.CBG18237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]