SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG19042 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG19042
Domain Number 1 Region: 167-559
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.87e-47
Family Gastric lipase 0.000000681
Further Details:      
 
Domain Number 2 Region: 1210-1396
Classification Level Classification E-value
Superfamily MIR domain 2.35e-37
Family MIR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 2076-2209
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-21
Family SPRY domain 0.015
Further Details:      
 
Domain Number 4 Region: 5591-5669
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000677
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 5 Region: 1667-1797
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000019
Family SPRY domain 0.043
Further Details:      
 
Domain Number 6 Region: 1094-1173
Classification Level Classification E-value
Superfamily MIR domain 0.0000000235
Family MIR domain 0.02
Further Details:      
 
Domain Number 7 Region: 3447-3527
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000144
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Weak hits

Sequence:  CBG19042
Domain Number - Region: 2681-2804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000353
Family SPRY domain 0.031
Further Details:      
 
Domain Number - Region: 1433-1540
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000432
Family IP3 receptor type 1 binding core, domain 2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG19042   Protein: CBP28664   Gene: WBGene00038324
Sequence length 6513
Comment CBP28664 WBGene00038324 locus:Cbr-unc-68 status:Partially_confirmed UniProt:A8XUM8
Sequence
MKLIILILLLILYSLCDEITTSTSEEDTDMTATPSTTTPLLSTAQNPGLPKTSILPIALK
SPVPTFSFSSLSTNDWLSSMPTVQTLLPPPIAPTTMEVPDKETFGFNSLTPLWTIPTKTP
VISPINDSPIKPMQDVFPPFPTMPTLPTLAPFTFPTLPPPTTMKPLNITIDPEAIMDVPE
IIAHWGYPVETHKVVTADGYILTLHRIPHGKSKHIAVTNSSFPNTKKLLEMRPRNPHPKC
LNRSSFCNTDFFVRLRFGYSICRDRYIFADQGYDVWLGNMRGNTYSKQHVRMTSSDRRFW
KFSWEEMARYDLPAMINYVLKNTRQSNLYYVGHSQGALTMFAKMSEDPEMSTKVRKFFAL
APVARMSHVKGLFHDLGQIYEQYNLVYQVFGDGEFLTNNIFTKLLTDIFCDQAVNNPLCE
NFIFAVSGPNSNQFNNSRIGIYLAHNPAGTSSRNMLHFAQMVKTKRMSRFDFGKDLNSKI
YGAPLPPEYDIRRINSSIYLFYSDFDWLANPKDVEGFLIPMLPTRSLKKATKLRDFNHND
FLWGMRARKEIYEKIINTIKLDQRRVKLQNSMDRFFEKEVNEDDEETEYRQWPFYTVFRS
KSTTIREISERNETEPRLGVHLFSFCSKKKIETSINLKHPHNFPFVLSCSSFFFFFLAFP
LWYHLHFVSFLTDEEQGGGEQDDVSFLRTSSSVRSEFYEILLSFSLEIRCNKKIVSERCC
FIVTQREFFCPLGKKYAVNSKKSEASSFESYSVPFRLLSSSPLASFCAFISRPPSNFLSS
TTHIQPINVFLGTPTEELTLSDFQTSHYPHQRVLLVFLITLSSIFSSSNFYRIYSKYVIL
YDNTSLYYIDIAEIVSSMFKVPLFKFSANSRRTFQKSSFVRPLFPVDDSDLSLENKQGSC
FCRFDLASRLSFSFHLHPRICYVAHMAFCRPGPAYCFFVVFFLLADYSLFFVLMVTLQFS
DKETPLFTLEVCSRQQNHRTRQKTAHKRKNTRYTTQYIHDHNYVTKGDIVCLSCVASHNR
DGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSMRALQEMMSADSD
HKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWT
IHPASKQRSEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSM
RTRNMGFLFGNDVLRLFHGNDECLTIPENWSEHPQHKSSSKKSENYFSMVIYEGGAAVTQ
ARSLWRVELVRMKWHGALVGWEQVFRIKHITSGRYLGVLDNAVQLYHKEKADFELTAFVM
CQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTSEVTKKGLGKVEEK
KAVALKDGHMDDCYTFFMALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRV
DLNEVLKLMEDLIEYFAQPNEEQDFEEKQNHLRALRSRQDLFQEEGVLNMILDTIDKFSQ
MEALPDFAGLIGEETHIKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSNP
QSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAV
RSSQNLITQYLLPGKDLLLQTSMRDHVSSMMPNVMLGVVDGSALFRKWYFEAEVEHIETM
TKQTPYLRIGWANSVGFKPFPGSGDKWGCNGVGDDFYSYGFDGKSMFFGGKSRIVGHKLL
EKGDVIGCSIDLTIPEIRFSVNGSYMSGSFKKFNTDGYFFPVMSLSAKVSCRFILGGNQG
RLRYGPPTGFSAVVEAVNGELGITDCLSFGDLGKNIFCGPQTIFNNLEPFIPTPIDVSTT
QLTHHAMEMHQKYAENLHELWAMRKIELGWSYGETRSETSRKHPCLTRFELLPETEKKYN
IMLALTTMKTIEALGYHLITDDPPCRLRAVRLAQNFQQSNGYKPGPLDTHEIQLPVELQP
LTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAAE
NIRALQLFGIFLEPPAHEHDEIAEKELRARKDNTRTYRAEATYAVNGGKWYFEFEILTAG
YMKIGWMDIGSTPEIQLGADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDR
TISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSGQRGRLNFGQQSNSLKFFTTCG
LQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVTRIPATGNSPPCLKILQKV
TISEGGPSEKAKMEYIRLSLPVKCNDTFVKNKDKEAIRRQLQDYKPRSQSVVSQIRAPGI
PKEFDDNKEKKGFLRSMLGSKDSHESDDDRNRSRTTSKQPSIEGDEPPAVRYVISYFRLL
FSFIFSTRSRYSQRRRVLTLMNFGMYSFDESILTWLHVNEEDNHKWQDVLRRSLLELPHE
ERQIAEEHMRDLNDRHAEKPKKGGILSRLRDSSNTRKNFRDSDRRKEDKAAALRQMKSNS
RSFDAGSLDTSTLPTGQKDVLDPIWVLQDQFHEEDTVSGEKQAPHQSLSFLAKLSYNLSL
SPYLPKTFSSLSNAAWYSKTDVKFEFSASSEMPLSGPGRQLTIKRGSVKKGKKGKKAEIA
LEKAMEREKKGSIIPMEAQLDVLQEGDAHALVALKDKVDEYYYGVRIFPGQDTSQVWVGW
VTTQYHYYNVHFDGNQGVRKCRFSEADHHGTTVDSVQSQNCYMVNVSELLEKTADVANTK
VSGTLIGCIIDTSIGELSFQVGTTDTGVKFKLEPGAMLFPAAFVTPTATDILQFELGRIK
YTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRENEGQC
WGEGVARGRSVQRKGGQMGESERQVRRRRTTVLLLFSGWSVLCNDPVRIMSVYIPEKDQS
LDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPM
RQGFHDLLIGIHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGQSVSML
SQMAAEPVKKHISREEEMKLLPPSVDFDALKKHVMESLQSATHHAVMNCRDLIGGDNTNH
FEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDESYKNGTTQKGLTQLELAEPVKLQL
VSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRC
PPKEQMFRLLMCKVKEERDPEFMEEDADVDQCPMAESLQQQLRDFCELLVGKIGNAKEGE
SEDQLALIESEEGSWVDSFARIVVKVPPPLEEEGMEMQKKGTQNFREIIVTMLREWAQAD
FIESKDLIRSMFKLLLRQYSGIREIRDAMSQAYVFHERNAADVTDFIVYLIQIRELLTVQ
FEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDEV
KEKAPIKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPL
DVAYSSFMDNNELALALKEEELDKVAVYLSRCGLQPNSELITKGYPDIGWDPVEGERYID
FLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAIALSEDIRLLE
NDSHPSMLTSGLLGENPTYPSKEIEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAG
KGDSLRARAILRSLISLDDLGQILALRFTIPNLAAPSIEAVRRANAVQASHTQKAVMAHT
FAMVASLASEVSNTRRSQTFTSGANLARRGFELINSHLFPFLTPSLSRLPCVEEVDSDDS
KSSDYASVHTSFSSGNELFAPKSEKQKAELQLLNEKKYPIVQRRRSSRYNPIDNTGPLPG
LLPNHKGSVLLFLDRVYGIDQQDMLFHFLEQSFLPDLRAATMMDSPRALESDTALALNRY
LCNSVLPLLTNHSHFFSDAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRE
LPPGMMIKLLKKVINDILTMNDMNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLS
MLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYSLTSGLEDVRNKRCPLVYKNF
VFQKREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGGLYSRA
NFTHPRLKPFALLKDFLILSFQEKSFYKERCSECLKALMAWSYSFDMVDRDANDRASAAR
TLSGTSISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPL
VPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQNDRMKSEGERSSVEKRFAY
NLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNY
FLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLR
TLVKVNSDIVRTSLLTFFNNCADDLYAAVNELKDGGQYSLIRGQALKSWNSFEFANQMIV
PVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLNSSISHRKFISSESEKHRP
GLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAKTQDQSVQVQEMLQNLSTHIPHLEKLLT
DLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFNVGPDGKRDKDDQRASVIQTTSVSCD
HINRIFNALLKMIRNHVGIENAPWLCRVNCNFIIFAVQIIQNVTSDPVREFVLPIAERLR
RMSEKAYKEEEHMRTHPDDADEGTVAEVITTERSNSTSFNSRTTLASSYTDLHRAQWLKS
PTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAAMGGGDMKTGKAAIAERKK
KRREGQVSSRGSQKIRISKKKRSKTIIIQDKMKEYFDRNGRPIVSFDTTEKPFVEQICCV
SSSDYFDHSIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIR
EFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQEAVIEKIFNMGQVSAILH
VITRTKDRRRRAHHRWKYNRKQHLTQMNNSDTEHPQMQLSQAWKKVVVQLSRVSAWFRCT
EYQEGRHLEESAYIAKKANGYFSHHCLSFVQDRIDQLIADICTGIEEEEGPRIEIIMEEG
VPIVASSEEPKEKETNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHI
EEEDGDDGEEGEIDQAAKEEQTQALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTL
QLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGM
GAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYL
LRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANS
RLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQ
MVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMY
TVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKI
IEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQ
DDGGDQGKLEAFINFCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFLQQTTASDQISE
TFKSGYNYGISAASALSPQNITTTIKNVTTSVRQMTWTQLLYSIIILIIRAGLAIGWGGY
LLLMTIFRFAYFLTTSSEEEETAKNDSLKEPPKMMNHEYVNIFKIHKYSFVFSHATFSPP
IAQEFHHSHVGVDAFGVGMNADHLNVNSLPDFVPPPRPETPETVLSEEEKPLNSEPQSPT
SPTAASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKTKGSILNMLARNFKT
IEKITLYLAFFINVILLFHRVDISHTEAAETASEGDDDEDAVESIFITGLQFPYMEYEIT
GWMLAQVLYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEE
LGIVDTFMWYLDRIVISAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDS
SYDYRYSCWLWIGVIFTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAIL
QSVTHNLQQLILTIMMTLVVVYLYTVLAFNFFRKFYVQEGEDGEEPDRKCHNMLTCFIYH
FYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIVILLAIMQGLIIDAFGELRDQ
QESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQ
ETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Download sequence
Identical sequences A8XUM8
CBG19042 6238.CBG19042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]