SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG21757 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG21757
Domain Number 1 Region: 85-118,176-236
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-23
Family Voltage-gated potassium channels 0.0053
Further Details:      
 
Domain Number 2 Region: 312-402
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-18
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG21757   Protein: CBP33627   Gene: WBGene00040451
Sequence length 768
Comment CBP33627 WBGene00040451 locus:Cbr-twk-8 status:Predicted UniProt:A8Y0K1
Sequence
MPVLLRAVGFGRSSNNNRNLRPGSGASNDRLRRPSQLSAGAQSSATRHSNPDRDKVVQSR
LHEEPEEKEPETWGKRFHRMYKEYHIKVISIYLFPLIFIMFYMLIGAIIFYFLESGTAEE
VAQEEDYKYKRERRLLLLRMEELVQDAASRRRKFREKALEEAIDNYEQKLDFSVKNESQW
TFMSAMYFAGTLFTTIGYGDIACTTSAGRIATVIYSCVGIPFMLITLNDLGKFLYNNING
CVKGFEDFTTYLGAFRLCRRGNGNFPKGDELVNLETGNPDIHVEVSSLASELGSERNESD
YEDIEDEEERAMPRMSVKVALGITVGWIFFCSALFKLWEDWTYGESCYFMFISLSTIGLG
DVSVQRRDMMVLCFVFVIVGLSLVSMTINVIQVALEDFYVNLIMKLILDYQEKMAAGGDQ
MGASVGMMRMWGNNKTAKLLMPLLSKEKKKMAMEKVEVKAKNNGIEIPAILTDLDEKSGM
PKLFHIEEQQEGEEPPKILEELVQKQIEIEEAAAENAVLFVAHDANTQTDILLQEEKCHQ
TDEKQYGEDATQTEAMQLDNLECETQTETIHNSIAETQTLIVDYSDSDTMTQPVISNESD
SQTEYVQTKEEELQTYIDTNDMETLTEIETKNVRIQTPQPVIEQKCVQTDDLHEDRKSPS
KMSSAKKRLRRAFAGKSKPTRNSLEHPVMSDWKDVEESETQQDEEEEELGSVESLHWDPV
DGMHAEKQLPVKKLKALFDSPKGQRKLERRVSSFNKKRENSRSRNKSE
Download sequence
Identical sequences A8Y0K1
CBG21757 6238.CBG21757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]