SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG21910 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG21910
Domain Number 1 Region: 69-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-22
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 185-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-16
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG21910   Protein: CBP31266   Gene: WBGene00040580
Sequence length 463
Comment CBP31266 WBGene00040580 locus:Cbr-twk-1 status:Predicted UniProt:A8Y190
Sequence
MSFHDEEGGSDKKTIENGRNVEEKDELIENPIVVKTRKKKRTLPSWLDRPYHIWRDQFQQ
DKCCPKKRVKQELIRSSIYVLFLNVFLCSYILFGSNIFTLRHTSTEKEASFLDSVLFCIT
TISTIGYGNIVPFDDQGKILCILYCLIGIPLFFMTVATNSMLVLEICNIIHRSFSLKEAI
NKTDLRWYTSAILLATHCFIGSLIFSFWIDELPFLDAFYFSFISITTIGYGDYSPTPEGP
FQYAVVMIYLCTGVATMLIFFSSLQRGIMWIHYYGRKVSDSEEAEIWYGGQMMTVKDLVS
LVAQKFGSTPEKLREVMHDLDKILEVACQEAENNEEDDEEAECRRLFMNAESPVSPPMPR
KKTVFLSGSSEGDDYQATIHSFTSINQRSIPKETENAIRALGDLQHHLRKPSVRARSPHH
SRMIAKPASDTNIEAKEHITSLDLRKMAHRVHSDGRLLVQNTV
Download sequence
Identical sequences A8Y190
CBG21910 6238.CBG21910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]