SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG22292 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG22292
Domain Number 1 Region: 11-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.67e-66
Family BAR domain 0.000000795
Further Details:      
 
Domain Number 2 Region: 286-371
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-24
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG22292   Protein: CBP33757   Gene: WBGene00040890
Sequence length 375
Comment CBP33757 WBGene00040890 locus:Cbr-unc-57 status:Predicted UniProt:A8Y200
Sequence
MSFSGLRKQFNKANQYLSETMGAAEPTKLDDVFNDMEKNIDTTYNLITDLVAGTNEYLQP
NPATRAKMATQVALSKVRGTTKTSPYPQTEGMLAEVMQKYGQQLGDGSDLGKALNDAAEG
YRQMADIKYQMEDNVKQNFLDPLMHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRRDDE
MIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGH
RIKDAASRPREEHVPLPVLGNESRTPRSRSPAPSEMTHNSVQPATNGGGMPSQAPPAYQG
GPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTIIELVSQIDENWYEGRFNGKT
GLFPVTYVQVLVPLK
Download sequence
Identical sequences A8Y200
CBG22292 6238.CBG22292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]