SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG22456 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG22456
Domain Number 1 Region: 3-24,152-226
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-20
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 286-387
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-20
Family Voltage-gated potassium channels 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG22456   Protein: CBP36001   Gene: WBGene00041010
Sequence length 673
Comment CBP36001 WBGene00041010 locus:Cbr-egl-23 status:Predicted UniProt:A8Y2B8
Sequence
MIVSVGAYAIFGALVMRSLESKTVTTIEKKTDVHRRHANLTSVELPTITPLPLELRHRRR
RRHNETQSPISDRESREKRAAAHVMRSRKCVIGVIKKMSSMECSMDTLDEKLVKALDECY
HVAVEHNTHVNHVLYTNSKEEVESVGEEAEEEVAEWSFMDSLLFAFTVITTIGYGNVAPR
TFGGRLFVIGYGLIGIPFTLLAIADLGKFISEMMVVAKTFCKKTWKKLKKAWNPNFIRYP
KLSGAKDLSNTDIEEKILENEKVENEIEETSETSEEEDDLTETEATSLFILFLVYIAFGG
MMLAAYEPDMDFFKAVYFNFVTLTSIGLGDIVPRSETYMLITIVYIAVGLALTTIAIEIA
ADALKKLHYFGRKIENVGNVAIWFGGKKITMKALVKNLGDQFNLPTTVVKSLNLDHFVDQ
AIKVEEGEIETLRPPPFEPDSERFDAEFADEPESEWIRDPTPTPPPTPKPVYRLPSPKPK
RHHHLRHQVRRSQMTRWLLPHRLQKNPMMIKVQKKELILPSPEPSPIREPTPSPPPREPT
PREPTPEPEPYREPTPPPPPPPKPRPLTAAEIAAQKRKAYSEEAWRRYQEYQKQWKKFRQ
TQKTPAPSSGASTSKQAASGASPEGGGIGGTGPSTRSQSVTSVASGKTSRSATPESKKSS
HPSSSSRRESGAK
Download sequence
Identical sequences A8Y2B8
CBG22456 6238.CBG22456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]