SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG22661 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG22661
Domain Number 1 Region: 339-444
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.77e-19
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 189-259
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-18
Family Voltage-gated potassium channels 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG22661   Protein: CBP33930   Gene: WBGene00041177
Sequence length 579
Comment CBP33930 WBGene00041177 locus:Cbr-twk-9 status:Predicted UniProt:A8Y2T1
Sequence
MNSTSTTKRYRLEYCILSVNKVTDHKVGPAGPAGPAFFCSFCSVTLFIDKIQYSKSYRHN
TLRSCRFDCWCCHLHSLRRAMLKRELSDLPSRPPPPPSISGLPDRITRVYLGEELAILDP
GIHDCLERTILTLFHETKCDPYSFEHLNIDHIDRCYAEANVPIPAEFGKQPRRKIKKKEE
EKPIDETPQEKWSIGNSVIFAFTVITTIGYGHVAPETFEGRLFLICYGVIGVPFTLLTIA
DLGMFLTKFLKYLLTMARRFSFFLVKFFRRFRRKGTQKTSPVQPDSERSEVWSTDKEMKE
MRTAREPGEEEEIKKDGEEEEEEEEEEKNDEPRKTEESIALGITFTCYLVAGAKILSVYE
PEMDFFKALYFNFVTLTTIGLGDFVPKSFDYLLITLIYIGIGLALTTMAIEIAADLLKKL
HYIGRKMENVGQAVVWFGGKKMTMKSLVKHLGDQFNIPEEELANFDMSAFVDNAIKVEKG
EIATLRKPPTPEPVIFRERAFSYSNLRKSSESALKYVDDQRFSKMTEPTVVLHETTRTID
TLHNLIPRLDLDVHYLTDMSAPTSFDEHYLRTYTNARRK
Download sequence
Identical sequences A8Y2T1
6238.CBG22661 CBG22661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]