SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG22924 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG22924
Domain Number 1 Region: 165-198,268-356
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 367-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-25
Family Voltage-gated potassium channels 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG22924   Protein: CBP27948   Gene: WBGene00041374
Sequence length 564
Comment CBP27948 WBGene00041374 locus:Cbr-twk-7 status:Predicted UniProt:A8Y3N2
Sequence
MTSTSRGYQRVDSSDVGSLVMEEDGDNPHEALLHRNNDDYASTYHHVGVEYDSYEEMERQ
ELDDRVAEIPEGFHRRQRRVYEDLLFGIEVAEEEEIRVLGRKLRTREALFGEEVTRAGLG
RAEYYEDSHMIHSCDKSGHEDIDDESDDETKDEDEEEEETGIRKFAKLVLPHVALVLLTC
TYTVIGALIFYSVEQPHEQMMKEQQLKLIYTRQNEFVDDLIRLAAGNETKRYEWETLAER
HMHNMSDQLFVAFEKYFLTSNEVKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIG
RIWCILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRHRKERREHVCEHC
HSHGMGHDMNIEEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGF
GDLMPRRDGYMYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARSALAVVGGK
VVLVSELYANLMQKRARNMSREAFIVENLYVSKHIIPFIPTDIRCIRYIDQTADAATVST
SSSAMDMQSCRFCHSRYSLNRAFK
Download sequence
Identical sequences A8Y3N2
6238.CBG22924 CBG22924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]