SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG23427 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG23427
Domain Number 1 Region: 439-519
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-21
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Domain Number 2 Region: 169-201,295-379
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-19
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG23427   Protein: CBP29370   Gene: WBGene00041788
Sequence length 656
Comment CBP29370 WBGene00041788 locus:Cbr-twk-24 status:Predicted UniProt:A8Y3Y0
Sequence
MHTVFSLFEASLCSSDHSAISLIAVWSGVTHIESASDFSEEVVAKVPSGLTILAILEILG
FSVDFAQWLKPLLPCFSNFFNSVFFRNFQFRDNSEELSERHSLNATNADKISDTKVVIED
ESKKKKKKKKKDKILDAEELPQQEDPEVLAAKEKEKQAKIMIANQDARNKTMWRHMAWLV
ILFAFSLFGGVIFSAIEGLFHSFLMLPLHLDYIFFAGGYETTQLIKKFEHEKDVYERRKI
YQEQLFQRLREIEQDNTNPRGRNSSREHFKLEQSRHALEWYEQKMGVTIVEPQMKETKWN
LWGGVYYSASLYTTIGYGNFHPLTKSGRIISMMYACVGIPLVFTILLDWGFLYFTWIEYG
WNRFNENFCQKSLQRDMQRRIRRERIRRVGSELSMSSTAPLLHRTTTQLSNPAQHIESNH
PLTPLDIDVPMGEQVQTVPIKSAAIFFFLWIMISAFIVRLWEYEWTYFTAFYFFFTSLTT
IGLGDVVTKTPNFIIFNLAMTLVGLSVVGLCVAIVQAKVKLVFDRMLRSIDAQYRIRQVD
PHVATMSIVEDEEEGVKRLIQSQSLEDRIIFLFVDEHKKTMLKERWKQKSSMVNRITQTY
PSKADKYVQTGQRVYDQQQGSDEELSDEDEEDVEYDELGNKIVLPPVRRYIYTVFD
Download sequence
Identical sequences A8Y3Y0
6238.CBG23427 CBG23427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]