SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG23453 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG23453
Domain Number 1 Region: 123-164,233-299
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-26
Family Voltage-gated potassium channels 0.0048
Further Details:      
 
Domain Number 2 Region: 414-497
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-24
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG23453   Protein: CBP33199   Gene: WBGene00041812
Sequence length 646
Comment CBP33199 WBGene00041812 locus:Cbr-twk-13 status:Predicted UniProt:A8Y3V6
Sequence
MFARAKFAHHIYRRVKPCFRGMLNPMYMKHRASTPNPQVSCQPSTSSFQRHHRPSSPGIS
LGPPSSPPSLYNLQQIASATAVDQQNNNDVEELSAERLNLYLDKQEGEIENLDEEIDEST
EKKWWLRTKRWFRLALPHFGLVLLSIGYTLIGAFCFHHYEKPYEQQLRNETSLRIGALKN
RVMDQLWRMSNNGTAYSTWRQTANDGMDELIRDVFWDYTRNYMTPDDVIYGDGPIKWSFM
SSIFFSWTAITTIGYGHIVPRTDEGRVAIIFYALLGIPLILVTIADIGRFLATYIIKLHH
GYMAVMSFITNSCLKCIKWACCWIRLPRRHIPMPTLELLQRTQKLYPNNNPTVAATAASA
GGGTGRKKKQQRDNVSDAGTFDNISEINDGSEGGENENEGEEEEQVQFDPSNHEKRVSVL
FILLIMLGYVAGGAYMVRWWEEWTFFEAFYFCFVTVTTIGFGDIVPANVDWLPATLAYIV
FGLIITTMCIDLVGSEYIRDIHFYGRSLGRQFMTIGGKVVHLGEVFGYVAFLQKNYGLTA
EQLTKLSQLPEEYLLDCLINGRQPDLNWIGGRPYVPPDIYYFKWIEHPRTLSFASDRVLQ
SMESLDLNTSRCSTARTLTPREYYQKILFQYCKQLQPEEPIADIDN
Download sequence
Identical sequences A8Y3V6
6238.CBG23453 CBG23453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]