SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000086517|PACid:22622827 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000086517|PACid:22622827
Domain Number 1 Region: 493-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-82
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 72-182
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-24
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000086517|PACid:22622827
Domain Number - Region: 344-386
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00549
Family Anti-platelet protein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000086517|PACid:22622827
Sequence length 826
Sequence
MEIFTMLFVLSSFLFSPSISAAKDIITPTVSLRDGESLVSSGGTFELGFFSPGNSXNRYV
GIWYNGISPQIVVWVANRETPLTDXSGALNITXGGVLVLFSDKNXSLWSSNXTSRXLRSP
VAQLLESGNLVVKDGNXDNSEGNLVWQSFDYPGNXLLPGMKLGWNLXTGXNRXLSSWKAA
EDPSPGXFSYSIDHSGYPQLVLRKGRVPHYRLGSWNGLGFTGSPELSPNEAFKIEFVSND
SEAYYKFDLMRDSMHSRLVLNLSGGLQRFLWIDKTHSGNMIYSAPADXCDTYDLCGAFAF
CKLDSVPLCSCLQGFVPKSPXDYWTMKNTSSGCLRKSPLNCTNQDEFQKFIRVKLPDTSS
SRINNTMSLEECKKMCLTNCSCTAYANLDVRGGGTGCLLWFGXLIDIKXFDSVGQDLFVR
MPPSELDGAKRSKHSGVQRKVAIIVXSGAVVMGMLILGLVFYIQKKKSKARGNMKNIREK
NFGFEGGSXDMELITFDLATVSRATDNFSDNNKLGQGGFGPVYKGILKEGQNIAVKRLSK
YSGQGTKEFMNEVVLIAKLQHRNLVKLLGCCIEGDEKMLIYEYMPNKSLDYFIFDDTRSK
FLNWDQLINIIGGIARGLLYLHQDSRLRIIHRDLKTSNVLLDKDMNPKISDFGTAREFGG
DQTEENTNRVVGTYGYMSPEYVVDGLFSVKSDVYSFGVMVLEILSGKKNRGFHHPDHQLN
LLGHAWILWIEGRPTEIMDEKLDGSCAPPEVSRCIHIALLCVQQQPEDRPNMASVVLMLG
GEGSLPIPKQPGFFTERNSVEANASSPTKYESHSINEMSLTLLEAR
Download sequence
Identical sequences MDP0000086517|PACid:22622827 MDP0000086517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]