SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000086882|PACid:22649493 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000086882|PACid:22649493
Domain Number - Region: 284-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Integrin beta EGF-like domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000086882|PACid:22649493
Sequence length 794
Sequence
LXIQKWKCPXSQIATVTSVVALVSIVLVPIVHLFWFPLVPSFAYFSQAQNSCVPINGSAD
SIXDHVKGNXKSPMDLDRQFPSDLHKAVVFRGAPWKAEIGRWLAGCHSISNEVDIVEIIG
GSRCKNDCSGQGVCNHELGECRCFHGYSGEGCSERQQLECNYPATPDLPYGRWVVSICSA
HCDTTKAMCFCGEXTKYPNRPMAESCGFQVKLPSEPGAPKLTAWAEADLDNVFTTNSSKP
GWCNVDPAEAYALKVKFKEECDCKYDGFGGRFCEVPTVCTCINQCSGRGHCRGGFCQCNN
GWYGIDCSIPSVASSVREWPQWLRPAQVDVPDSSHLPGKVDNLNAVVKKKRPLIYVYDLP
PDFNSLLLEGRHFRLECVNRIYDDRNSTLWTDQLYGAQMALYESILASPYRTLNGEEADF
FFVPVLDSCIITRAXDAPHLSXQEHKGLRSSLTLEYYRKAYDHIVEQYPFWNRSSGRDHI
WFFSWDEGACYAPKEIWSSMMLVHWGNTNSKHKHSTTAYWADNWNDISSDKRGNHPCFDP
DKDLVLPAWKSPDVNSLSSKLWSRSRENRKTLFYFNGNLGPAYPNGRPEASYSMGIRQKL
AEEFGSSPNKEGKLGKQHAEDVIVTPLRXENYHLDIASSIFCGVFPGDGWSGRMEDCVLQ
GCIPVVIQDGIFLPYENVLNYESFAVRXREDEIPNLINILRAFNETEIKFRLANVQKIWQ
RFLYRDSIMLEAERQKTVFGRMREWAAQFSQLIEDDVXATLIQVLHYKLHNDPWRQHVHV
KREFGLPQECLFES
Download sequence
Identical sequences MDP0000086882|PACid:22649493 MDP0000086882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]