SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000123144|PACid:22659791 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123144|PACid:22659791
Domain Number 1 Region: 100-163
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000405
Family F1F0 ATP synthase subunit C 0.014
Further Details:      
 
Domain Number 2 Region: 173-208
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0000314
Family F1F0 ATP synthase subunit C 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000123144|PACid:22659791
Sequence length 211
Sequence
MEKEEALGGWGLGRNAGPRVGNIQRCWHNVLEGTRSTIGSLLTPSRSKRLAALSDSRRRL
SLGSAADTPITERGRERSEIPNPRFAMSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGT
AKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYA
HLSSGLACGLAGLSAGMAIGIVGDAGVRYKF
Download sequence
Identical sequences MDP0000123144 MDP0000123144|PACid:22659791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]