SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000124621|PACid:22673965 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000124621|PACid:22673965
Domain Number 1 Region: 492-803
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-81
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 75-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000124621|PACid:22673965
Domain Number - Region: 346-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000124621|PACid:22673965
Sequence length 824
Sequence
MQALRSFYMCLFFLFSLLRISAATALGTTITPSGYIRDGETLVSVGGSYELGFFSPGKSK
SRYVGIWYTDSTDAVVWVANRETPLGDSSGLLMLTEQGVLVLLVNSSNKIVWSSNSSRIA
GNPVSQLLDSGNLVVQDGNETNPDNFLWQSFDYPCDTYLPEMKLGWDLVTGLERYLSSWK
STEDPAPGEFSARIDYRGLPQLFVMKRAKKVGRGGSWNGLHLTGFSSGQPNPISRIEFVW
NKDEVYCQFRLLNRSVFQRLVLSPLGVSLLFTWEYQTHSWEFASTLQEDRCESYALCGAY
TICKINNSPICVCLKGFVPKSPQDWNSGNWSDGCVRMTPLACSHGDGFLTYSGVKLPDTS
SSWYDKSMSLEQCKGLCLGNCSCTAYTNLDVREGGTGCLLWFDNVIDIREFTLGQDLYIR
MAASELDISDHVKKKSNFNKRQLLAILLSSAVFLMGMLIVGIILYIRKKKLKNEGLRTKD
CGEEYPGEDGEDMELPLFDLTTIAKATNGFSNCNKLGEGGFGPVYKGTLIGGKEIAVKRL
SKNSGQGTREFKTEVILIARLQHRNLVKLLGCCIQKDEKILIYEFMPNKSLDFYIFDQEG
QKLLNWPKCFHIIVGVARGLLYLHQDSRLRIIHRDLKPSNILLDNNMNPKISDFGLAKTF
GGDQSQANTNRVVGTYGYMSSEYAADGIFSMKSDVFSFGVILLEMLSRKKNRGFRHPDHD
HNLLGHAWIRWIQDKPLELIDKTFCDSCNISEVVRCLHVGLLCVQRVPENRPSMSSVVLM
LSSDVALPPPKQPGFYTERSVNESPSKTLLCSENTFSTTWIEPR
Download sequence
Identical sequences MDP0000124621 MDP0000124621|PACid:22673965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]