SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000126825|PACid:22645809 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000126825|PACid:22645809
Domain Number 1 Region: 61-110
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000615
Family alpha-D-mannose-specific plant lectins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000126825|PACid:22645809
Sequence length 236
Sequence
MDTKILLCYTLRFLLCCTFIACISTASHTISPGQSLSEAQTITSPSGTFELGFFRPRIPP
KYYIGIWYTNQSSQTIKTVVWVANRKQPVFEPKLSVLELAKNGNLTLSSPPKLQYGRLIQ
DQSFDHMSDSWLPAAELGYNNRTKRKLVLTSWRNLQNLAPEAHLKSMVSSRFMPGTKTFG
DGIRFQLNHRTNVRLICRVVLLVFATSCSILIVVALKDLNPKSGKIGDYMNSQMVV
Download sequence
Identical sequences MDP0000126825|PACid:22645809 MDP0000126825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]