SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000128295|PACid:22625136 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000128295|PACid:22625136
Domain Number 1 Region: 106-156
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000196
Family B3 DNA binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000128295|PACid:22625136
Sequence length 173
Sequence
MDFMQRDQKGYSDKEDQDQEQEDQEEEEDIITTSNSNYGSSPKYKGILLPPPPPHYHQQY
GRQKPWLDVQNHGSPEAINFTDLSLNKDQVSDGGTDQNYWPPNSEREHMFDKVVTPSDVG
KLNRLVIPKQHAERYFPLDSSSNDKGLLLNFQDRTGSRGGLXTLIGIAARAMS
Download sequence
Identical sequences XP_017179897.1.92800 MDP0000128295 MDP0000128295|PACid:22625136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]