SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000129765|PACid:22673448 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000129765|PACid:22673448
Domain Number 1 Region: 7-188,303-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-40
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 192-307
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-27
Family PHBH-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000129765|PACid:22673448
Sequence length 428
Sequence
MSLKKKPKAVIVGGSIAGVSCAHTLVLTGWNVLVVEKSCAPPTGSQTGAGLGLDPLSLRL
IQSWIQDPELLHQTTLPFTIDQNAXDAYAKNDAIDGEKKVKWTLTRDEELNCRAGHWGDL
HALLYNALPPNLFLWGHRFLSFSISSDKSSVIVKASSHETNEXIEIIGDLLIAADGCLSS
IRQSFVPDHKLRYSGYCAWRGVLDFAGNENSETIIGIRKEYPELGKCLYFGLGSGTHTVL
YELPNRRLNWIWYVHQPEPDLKPNSMTMKASSDMIQSMHKEAEKMWLPEFVRVIRETKEP
FINXIYDSDPLEKIYWDXVVLVGDAAHPTTPHALRSTNMSVLDAAVLGQCLKKWGAEDLQ
FALEXYQSIRLPVVRKQVLHARRMGRIKQGLVLPDRQLSNPETANPEECHELQQKLMPFF
TDVPSILL
Download sequence
Identical sequences MDP0000129765|PACid:22673448 MDP0000129765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]