SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000131006|PACid:22658797 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000131006|PACid:22658797
Domain Number 1 Region: 360-606
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-65
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 36-138
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000654
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000131006|PACid:22658797
Sequence length 631
Sequence
TLVSSGHIFELGFFSPNSSANNYVGLXHKSIFPRKVLWVANRDNHLAVTDTLASLTITSN
GKRNSVWSTNISVSSNGSAAALLLDNGNFVVKDNIRAAVQLWESLDYPSESLLPSMLNPA
QSFXWINGWTPFWRTGPWDNSKFIGIPEMGDQYQSRYRLDDNVQQGTKYFSYNLFNLVAY
LELSSEGILKLMYSKHEENWNLNWEGPQNPCDIYGTCGPFGVCEPSESSTIPTCKCLKGF
IPKSLDEWGRGNRTRGCASQTKLFCERNTSQSVASSTKRRWVLEDVKCKRCLVWSKDLID
IQEFSSGEADLFIRLVNAEFGCKQNQESSKARKEIRLTDTRDTSRESLQEYIRTHDPSEL
LVYEYDFDSIVIATSNFSITNKLGRGGFGIGKLEEGKEIAVKRLSSSSGPGXEEFKNEML
LVSKLQHRNLVRLMGCCIKDDKLIIYEFMPNKSLDTLLFDPMWRKELGWARRFNIIQGVA
RGXLYLHHDSCLKVIHRDLKASNILLDENMNPKISDFGPARIFEWTQNLANTQKVVGTLG
YMSPEYAMRGIISEKSEVYSFGVVVLEIISGWKNTSFYDHEKEPSFIPYVWHIWSEGKGL
YLVDEVLDVFRIRSDEMLAYWASLRARQCCR
Download sequence
Identical sequences MDP0000131006 MDP0000131006|PACid:22658797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]