SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000135504|PACid:22647453 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000135504|PACid:22647453
Domain Number - Region: 453-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0072
Family Integrin beta EGF-like domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000135504|PACid:22647453
Sequence length 612
Sequence
MKNENSNSFSNVHEESENKNPNIPASIPRCKTKSKKAAVNPSSEKKKQVDESSFQDSSKN
GRKPRLKTTFSASNLLGGREILNQITEFCTELKKLARRGSRKGRREGEKRCRRWPRLSKP
IEREQDEKKETKFKRKKTDTNEYLTGERHKQVLEGQKYGDIAEESSKIMLXIQKWKCPXS
QIATVTSVVALVSIVLVPIVHLFWFPLVPSFAYFSQAQNSCVPINGSADSIXDHVKGNXK
SPMDLDRQFPSDLHKAVVFRGAPWKAEIGRWLAGCHSISNEVDIVEIIGGSRCKNDCSGQ
GVCNHELGECRCFHGYSGEGCSERQQLECNYPATPDLPYGRWVVSICSAHCDTTKAMCFC
GEGTKYPNRPMAESCGFQVKLPSEPGAPKLTAWAEADLDNVFTTNSSKPGWCNVDPAEAY
ALKVKFKEECDCKYDGFGGRFCEVPTVCTCINQCSGRGHCRGGFCQCNNGWYGIDCSIPS
VASSVREWPQWLRPAQVDVPDSSHLPGKVDNLNAVVKKKRPLIYVYDLPPDFNSLLLEGR
HFRLECVNRIYDDRNSTLWTDQLYGAQMALYESILASPYRTLNGEEADFFFVPVLDSCII
TRADDAPHLSMQ
Download sequence
Identical sequences MDP0000135504|PACid:22647453 MDP0000135504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]