SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000138005|PACid:22620884 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000138005|PACid:22620884
Domain Number 1 Region: 29-266
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-36
Family FAD-linked reductases, N-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 393-496
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.32e-23
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 
Domain Number 3 Region: 29-81,290-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000265
Family FAD-linked reductases, N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000138005|PACid:22620884
Sequence length 516
Sequence
MDPKDPFSADFFDGSVLSHIERQQNVCPSVIVIGGGISGIAAARILHDASFKVFLLESRD
RLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDDSVLYDHDLES
FALFDMDGRQVPQKMVVEVGDTFKKILKGTEKVRIENSDDMSVCQAISVVMDRHPELSLT
DLTPNTSRQKGLAHEVLQWYICRMEAWFAADADVISLKNWDQAYKLRVLVVKEHVLSGGH
GLMVQGYDPIIKALAKDIDVRLNHSIGSPKRYLTLESSIFRSGWMYNTKGCTFLSLHXNL
NCHCLFLVTITSEVVWFYSQGATSYKNLCFLSSQKVTKILYGSNTVMATIEDGRNFIADA
AIITVPHGILKANLIEFEPQLPEWKVAAISDLGVGNENKIALRFEKVFWPNVELLGIVAP
NSYGCGYFLNLHKVTGHPVLVYMAAGRFAYDLEKLTDDAAVNFVMLQLKKMMSDATEPVQ
YLVSRWGTDVNSLGCYALDLVGKPGDIYERLRAPLX
Download sequence
Identical sequences MDP0000138005|PACid:22620884 MDP0000138005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]