SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000138197|PACid:22638283 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000138197|PACid:22638283
Domain Number - Region: 142-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000138197|PACid:22638283
Sequence length 323
Sequence
MGSMGPCSVARSDKEWRELIEGVGEYGLAQREERRKRGRKRLYRDKERDRERSQKEEDDE
IEEEPMFTERQKTTREGRDCQESKTPTGEDKQWRRNQGCRSLIKALTISSLFPFLYFLIR
DLHSTKREEDIGYCAGYVDIETCINSPRNYSCQCPKGYKHEGMDEKSCIKDNKWSKAILL
IISLVTIRVPLATSRGPKLFSGVLYLNDMLPNLSIFRLLDQRRKFNLSRIKVYVNGSQGF
SESVGPRFIFERVQKKLQMRIEAQGKYLQTILEKAQKGLTHDLKGPDNIEATRVQLTDFN
VALSNFMENERTSPRRKHNRDDE
Download sequence
Identical sequences MDP0000138197 MDP0000138197|PACid:22638283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]