SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000144306|PACid:22632489 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000144306|PACid:22632489
Domain Number 1 Region: 514-820
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-80
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 72-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.14e-22
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 
Weak hits

Sequence:  MDP0000144306|PACid:22632489
Domain Number - Region: 351-422
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0126
Family Hairpin loop containing domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000144306|PACid:22632489
Sequence length 855
Sequence
MQLVKRLLNVLVLHLLLVRLCSSLDTIKFDQPVGDGDFLVSKNETFVLGFFSPGTSTNRY
VGIWYKFSEDRVVWVANRDNPINGSSGVLSMGSDGNLVLLANTSQGLVRLWSTNVLISSA
RNDNIFAQILDSGSLVLAQQGSQDVFWQSTDHPTHILLSNMKIGLDRRSGINRFLMCWKS
DNDPGTGNVSLRMDLNGSPQLILYKNEAKWWRSGHWNGIQWGGIPAVQRNVVFKINFVNN
KDEIAVQWTVLDPSIYSVITIDGMGTLNQLAWQGQQHQWVSLWSAPLDACDSYGKCGQFG
NCNPYTNSGFNCTCYPGYEPTSPQDWDLRDGTGGCKRQKGSPSMCRNGEGFVKMKNVKVP
DTSSIKLETNLSLEACEVECLRNCSCLAYASADVRNGGTGCMTWYKDLMDTKQFTEGGQD
LYIRADAVVFAQYKKKSGAGFSSGKRRLAIILGASXSVASLLILAVLCWFRKRSRKERGG
QPELLNDPAAFGSRSYEDLPXRKEVDEHRGKTDLPFFDLTTVVAATENFSFANMLGHGGF
GMVYKFVVKIFESASPFQGNLADGQEIAVKRLSRNSGQGVDEFKNEVMLIAKLQHRNLVR
LLGCCIDKEERMLIYEYMPNRSLDLFIFDKNTKSSLDWRKRFQIIIGIARGVLYLHQDSR
LKIIHRDLKASNVLLDGSMNPKISDFGMARMFGDDQIEANTNRVVGTYGYMSPEYAMDGL
YSTKSDVFSFGVLALEIISGRKNNFQFENPSLNLVGQIWDLWTEGKVLDIVDLSLNESYS
THEVMRCIQIGLLCVQEYATDRPTMLDVVFMLGNETTLPHPKKAAFSFKNSXPDCSTSRG
ASSVNDVTVTVIEAR
Download sequence
Identical sequences MDP0000144306 MDP0000144306|PACid:22632489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]