SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000145410|PACid:22641538 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000145410|PACid:22641538
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-28
Family Protein kinases, catalytic subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000145410|PACid:22641538
Sequence length 218
Sequence
MTRGTLADHLYHNNRDIPLLPWEQRLQICIGAERGLYYLHSGTKGTIIHRDVKGTNILLD
ENWVAKVSDFGLSKMGITTASKTHISTIVKVLWEVLCARPAVIHTAETRQMNLAEWAKNC
HRNGELDQIIDPSMRGKIEIESLNKFVEIAMSCISDRGIERPPMNDVVRGLELALQLHQK
NIGSEGYNEVTDRCCAAYGSIQCISATIFSKIDDPNGR
Download sequence
Identical sequences MDP0000145410|PACid:22641538 MDP0000145410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]