SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000149906|PACid:22660650 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000149906|PACid:22660650
Domain Number 1 Region: 181-270
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000955
Family alpha-D-mannose-specific plant lectins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000149906|PACid:22660650
Sequence length 288
Sequence
MLRKRASSTRKSYTTCNSHQLCSVNPGNANCWTXIVYTEKTXKSMCQKKGLRKRVPWRSR
ENMELPLFDLTTVAKPLATSQAATSWEKVALDLCTRSLKSILVSTLNKVSPNYHQERTRV
QQIISSFGRNTYQSSSAPHDGFDTFGAVKLLHAQSPQLDILETSKLWFQXVEAFKWDSID
AVVWVANRETSLXDSSGLLKLTEIAGNPVSQLLDSGDLVVQVGNETNPDNFLWQSFDYPC
GTFLQGMKIGWDLVTGLARYVSSWKSTEDPALGEFSIQMNHRGLPQVV
Download sequence
Identical sequences MDP0000149906|PACid:22660650 MDP0000149906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]