SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000150210|PACid:22663655 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000150210|PACid:22663655
Domain Number 1 Region: 24-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-22
Family FAD-linked reductases, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000150210|PACid:22663655
Sequence length 271
Sequence
MWRRSFSSSSSTGTAAATTALKNKKWDALVIGGGHNGLTAAAYLARSGLSVAVLERRHVI
GGAAVTEELVPGFKFSRCSYLQSLLRPSIIKELELPRHGLKLLKGSHSSFTPCLDGRYLL
LGPNKDHNHSEISKFSKRDADAYPRYGNQLGNFCEFMDPLLDSAPPESLQCESSCSVSDR
FKNKMHNSMFWARCLRQAAALGQKDFVEFXDLLLSPASKVLNNWFESDVLKATLAMDSVI
GTTGSVHTPGSGYVLLHHVMGETDGERGIWS
Download sequence
Identical sequences XP_008338090.1.92800 MDP0000150210 MDP0000150210|PACid:22663655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]