SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000154144|PACid:22681364 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000154144|PACid:22681364
Domain Number 1 Region: 72-107
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000981
Family F1F0 ATP synthase subunit C 0.0089
Further Details:      
 
Weak hits

Sequence:  MDP0000154144|PACid:22681364
Domain Number - Region: 6-62
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000126
Family F1F0 ATP synthase subunit C 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000154144|PACid:22681364
Sequence length 110
Sequence
MTATSLGICILGMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVI
ISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRYKF
Download sequence
Identical sequences MDP0000154144 MDP0000154144|PACid:22681364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]