SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000156297|PACid:22667746 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000156297|PACid:22667746
Domain Number 1 Region: 99-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-18
Family alpha-D-mannose-specific plant lectins 0.0089
Further Details:      
 
Weak hits

Sequence:  MDP0000156297|PACid:22667746
Domain Number - Region: 391-450
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Hairpin loop containing domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000156297|PACid:22667746
Sequence length 698
Sequence
MMFLRGRLTRSNYVVTWFANRMLFSIFVSYAVAVLLCSSHPFCCARDTVTYDTPITDGVE
SETLVSSGGRFELGFFSPSPEGTQRYVGIWYHQPSPRTVVWVANREKPVDNSTXNGSLAL
QDGNLHVLDAAGXRYWSTEVXTSESLTQTVTLMDSGNXVLSSGHDKLAVNILWQSFQSPT
DTFIPGMXMDKXLVLTSWRGEDDPKSGQFIFKKDPVXEDQYVITKSKSDLESILYWKGGE
RATDAFYSFDQMLPAVTYLLSNFSKKYVERNYPKIFGSPSQNSYKNIAIPPQSEYKYTRL
VINITGEIQFLRWIEYTKQWNLNWSAPRDECSVLNACGNFGSCNDNNMPFLSKCLPGFKP
LYLEKWNSGDFSDGCARKSALCNKNDTFLSLKKMKVGNPDSEINVDNETECRNVCLNRCR
CKAYSYAKSENNSYRREASTSLCRIWNVGDLNNLEEEYNNMGQDLCVRVALSDLESTVRD
CKPCGTTIIPYPLSTRLGCGDPLYFRFKCNYFTGQVSFVGPNDALFRVISINSSTQRFFI
QGFHTENVDNSDPRNRAAKQINPSFPFKVISPGNADPGNFSSEVLSSGGPKVVEMGWELP
MEPTCTTSADCRDWAHSICKRARDGKKRCLCETNFRWNDLLLRCTQEGHLLGPPKEEHTR
RKLPLSLIIVAMLLSVIFLACIVISIYIWRRNMNNKRX
Download sequence
Identical sequences MDP0000156297|PACid:22667746 MDP0000156297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]