SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000156477|PACid:22668023 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000156477|PACid:22668023
Domain Number 1 Region: 675-838
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00000000000000536
Family Fucose-specific lectin 0.039
Further Details:      
 
Domain Number 2 Region: 139-403
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.00000000000000955
Family Fucose-specific lectin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000156477|PACid:22668023
Sequence length 1035
Sequence
MSLFFIWVLXTLRFLVADGSASSWCQQHHQHFLAQSSRQFEQKTDRFWEFKEQTKTWVEV
ELPYDLVSCLDDNCTVVGSIEGTGTSSNNSKQEQSPDSDDVPGKKEEERSEXKDKENCDH
KLLEVLPQRKRISLTRMSEMSIWVTGASGSIYERFWNGVQWVIAPHDLPLSPAHAISLFI
VNHTILALSESGNLFQMQISESSHPLWVEFTPTLSQNEGDQSSVILIKSGLVSYDAERVY
FCTKKGTLLELSEIEPPRWINHGQPPGANVAAVADAASIRTDVIYTISSAGDLYEYDRSS
KPSWKKHIWREGKANYNASLIPLTGNTLHGVTGDHSISLFLLTKDGKLVERRLHQRKWKW
VVYGSPKDQRLTSITPVLQDDTNERLFSLFFTTSTGSVFEYQISKQSGIAQAQENQVLEA
WVSHMHPLHAKVARGIAGLQIHVGRILFPLDDGRLAELHLSGLGGENSGPSHQVMLRRKA
TVKYVWSIVDAPETEGWNAEYCSEQRGPTNCVTGIKDEPNDLGIGRTMTRRRKGSQAQQH
YLTPGASGSGTIKFSEDNSFPYNWINTNXHLRAMHGGRSFFLITDGGFTFEYLYTESVWI
WLRHEHSTAIKGALGNYNGSLYVVDTYGSLLIRERSSNDLAWINCTALRKGRQVIGGPPW
DGIPGRTMKVTAEDALFFVSRTGRLLQFTVALRKFKWKDCRNPPNTKIASIVDQEHFREN
IVFVVGRNGRLYQYNKVTDLWHEHYQSQHLTLSRLPGTAMRPSSLSLTGSLFMLSADGGL
VEYHWNTFEGWNWVEHGSPHRVVTLVGSPGPSFEGNQLFLIGSNGNVYLRYMEEMTWRWK
NCGFPFLGKLIVEDRRQEEGNDKKEYFCTDVDFAASSKTDYERDNDLSSDCNPEVAPIRP
IPFAQDSVIFELRDGRLQGKGHILCPRFYRCKLRTHPSKLXSLSTASCPSSVAFGRNAPD
RRRALDMVPNHRHSDKLMHSKLLDCFGXVKERHNSTHDMYRSRIICTDYNIDVLVTYISN
KVSQANVXHNLHLPI
Download sequence
Identical sequences MDP0000156477 MDP0000156477|PACid:22668023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]