SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000157231|PACid:22653361 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000157231|PACid:22653361
Domain Number 1 Region: 643-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-25
Family Protein kinases, catalytic subunit 0.0033
Further Details:      
 
Domain Number 2 Region: 112-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000419
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  MDP0000157231|PACid:22653361
Domain Number - Region: 380-422
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Hairpin loop containing domain 0.051
Further Details:      
 
Domain Number - Region: 317-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000157231|PACid:22653361
Sequence length 762
Sequence
MAPQLGGANGRAPEVEILTRWPPHDSPFPNKKKVMYKIRGKAKSNVVDPDKIYDIDFAPA
VFLCSSHPFCCARDTITYGAPITDGVESGTLVSSGGRFELGFFSPSLNGTQRYVGIWYHQ
LSPRTVVWVANRETPVLNSTRTGFLALQDGNLHVLDAAGKRYWSAEELSKPTDTFIPGMV
MDKILELSSWRGEDDPASGQFIFKQDPVGENQYVITKSESILYWKGGERASDTFYSFDQM
LPAVTYLLSNFSKKYVVRNSTNIFNSPSQNSSYKNIEILPQSEYKYTRLVISITGEIQFW
TWINSTKRWKLYWSAPRDKCSVFNACGNYGSCNDNNMPFLCKCLPGFKPQYLPQWNSGDF
SGGCTRKSLCVDSKNDTFLSLKKMKVGNPDSQINVDNETVCWNQCLNSCQCKAYSYAKSE
NYSHRRDAHAPTSLCRIWNEGDLNNLEEEYTDGGQDLSVRVALSDLESTVRDCKPCGTTI
IPYPLSTRLGCGDSMYFRFKCNDSTVLSSRGPNVMAMGWELPMEPTCTTPADCRDWPHSI
CNPARDRKKRCLCKTNFRWDGLNCTQEGHLLGPPKEEHTRRKLPLSLXIVAVLLSVIFLA
CIVISIYIWRRNXNNKRDQIRRGQFDSERRVKELIDTSEFKEEEGIDVPFFDMQTILDAT
DNFSNANKLGQGGYGPVYKGVFLGGQEIAVKRLSRVSGQGLQEFRNEVVLIAKLQHRNLV
RLKGYCMKGEEKILLYDYMPNKSLDSFIFGSFLLLFSLSVTA
Download sequence
Identical sequences MDP0000157231 MDP0000157231|PACid:22653361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]