SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000165711|PACid:22635820 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000165711|PACid:22635820
Domain Number 1 Region: 509-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-79
Family Protein kinases, catalytic subunit 0.000098
Further Details:      
 
Domain Number 2 Region: 78-186
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-27
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  MDP0000165711|PACid:22635820
Domain Number - Region: 354-423
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0161
Family Hairpin loop containing domain 0.07
Further Details:      
 
Domain Number - Region: 296-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000165711|PACid:22635820
Sequence length 1037
Sequence
MNSTKWVAQMKNILLIFQLFVLPSCIFSFDTITLNKPIKDGDVLTSSKKFFALGFFSPGN
SRNRYVGIWYNKVPEQTIVWVANRNNPVTNTSGLLAVISHGGLVIYGNEKSTPLWSANVT
ASSPNNSVIAKLLDTGNLVVVENNGKVLWQGFDYPSNTLLPSMKIGLDRRSGLNRFLTSW
KSQDDPGIGNCSYRIEPSESPQLFLYKGQTPFWRGGSWTGERWSGVPVMTKNFIFNVTFV
NNEDEVSVMYSIVDESIFSKMVIDESGIVERSTWHDQVRQWVKFWSAPVEQCDFYGKCGP
NSNCDPYIADEFECNCLPGFEPKLQHEWYLRDGSGGCVRRNGSSVCQNGEGFVKLERVKV
PYSSATRVNMSMSLKACQEECLRNCSCMAYANADERQGGNGCVHWHGDMMDTRTYSDTGQ
DLYVRVDAIVLAQYAKKSNGSFGKKRKLEVSLISGLVFLLLLSLACWLVMRKRKGRRSQD
KFPFNVTXTPSYWEDSPARTDIDESRINSDLPFFELSTIAKATNNFSFNNKLGTGGFGSV
YKGVLYNGNEIAVKRLAKNSGQGIGEFKNEVLLISKLQHRNLVRIIGCCVQDEEKMLIYE
YLPNGSLDFFIFDEAKRAFLDWTIRFEIICGIARGILYLHQDSRLKIIHRDLKASNVLLD
SAMNPKISDFGMARIFGAEQIEANTNRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLE
IVSGRKNTGYYHDNPDSNLVGHVWDLWKESSALEIIDSSLGESYPVSEVLRCIQIALLCV
QEHATDRPLMSAVVFMLGNDAALPSPRQPGFLLKRTYHASGDPSASTEGAYSINDVTYGD
VLLSNKKIFALGFFSPGSSPNRYVRVGYNKVPGKTVGWVAKCQQRHPYHWDWTSHGGLWL
SHKYYASVYETWVXPAVFLTSXKSEDDPGIGSCSYRIDPGGFPQMFLQGSNSVVALELGP
DESIYFARMVIDESGTIEGSMWHDQARRRDKFWSAPVELCDFYGKCGPNSNCDPTNAHEL
SARAYPGSNPSCKMNGT
Download sequence
Identical sequences MDP0000165711|PACid:22635820 MDP0000165711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]