SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000168745|PACid:22640833 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000168745|PACid:22640833
Domain Number 1 Region: 375-625
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-56
Family Protein kinases, catalytic subunit 0.00049
Further Details:      
 
Domain Number 2 Region: 11-108
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-17
Family alpha-D-mannose-specific plant lectins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000168745|PACid:22640833
Sequence length 626
Sequence
DNPIIPLDGAGLLAIHGDHGDLIIYGKDQNTSLWSANVRVSSPNNSVIAKLLDTGNLVLL
ENNGSSXTVLWQGFDYPSDTVLPLMKIGLNRRSGLNWILKSWKSHDDPRSGNFSYEIDPN
GFPQLRLSGLPEITSNSHRSFVNNKDETYLVYTVPNGSVFTRGVVDESGTFQRVFKCGPN
SNCDPYSNYNFSCLCLPGFKPQVPPGLVSESWRGWMPEKIGSVYMPKRGWVCQGGTREGC
EQECRKNCSCTAYTNADERDGGKGCVTWYGDLIDIRTFSNVGQDLYVRVDATTLAQFANG
SVISKKARLAISLVSALVFLVLVFLLCWLIRRKRKGATGWVYYEAFYSLYYVKLMPTVIG
GRIKNMFFMEDRTDLDDQSEINSELPFFDLTTIAAATDNFSVANKLGKGGFGSVYKRVLH
NGKEVAVKRLSKHSGQGIVELKNEVKIIAKLQHRKPCQDYRGILYLHQDSRLRIIHRDLK
VSNVLLDASMSPKIADFGMARIFMGDQCEANTHHVVGTYGYMLPEYAMKGIFSVKSDVYS
FGVLLLEILTGRRNSSFYDKKYPHSNLVGYVWNLWREGKALEIVDSSMGESYHVNEVVRC
IQIALLCVQEFAADRPTMSAVVFMLX
Download sequence
Identical sequences MDP0000168745 MDP0000168745|PACid:22640833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]