SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000168905|PACid:22625438 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000168905|PACid:22625438
Domain Number 1 Region: 18-132
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000405
Family Protein kinases, catalytic subunit 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000168905|PACid:22625438
Sequence length 180
Sequence
MDWHLLSGDLHILEGPESLTHLHNFAGRCIIHRDVKSSNILLDDSMTAKVADLGFSKYAP
QEGDSCASLEAKSYARESKIDEIVDPNIKGAYHAEAMWRVVEVALSCIEPFAASRQNMIE
VVRELEFALIIENNASEYMRSIESSGSNHFSSMVMERRIPPPTPSEPSPILSQMAPPEPR
Download sequence
Identical sequences MDP0000168905 MDP0000168905|PACid:22625438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]