SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000170859|PACid:22644640 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000170859|PACid:22644640
Domain Number 1 Region: 400-691
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 81-174
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-25
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000170859|PACid:22644640
Sequence length 697
Sequence
MATLFLIFLLSLAINSPPSSSTSXTLSRASSLSVEKPEDVLISPDGVFTAGFHQVGNNSY
CFAIWFSEPSSSSDRHQNPTVVWTANRDRPVNGKRSKLSLLKTGNLILXDAGQSIVWATT
TTSLSPAHLTLHSSGNLVLRNSDDHVVLWQSFDSPTDTLLPLQPFTRNAMLVSTRSQSNS
SSGFYKLFFNNDNLLRXLFDGLEVSSVYWPDPSRVSWDNARSTYNNTRTAMLDSLGSFVS
SDNLTFMSTDYGARLQRXLRIDFDGNVRLYSRERAGEKWVVSWQAISDPCKVHGTCGANS
VCSYDLGFGRKCLCLPGYNMRNLTDWSFGCEPQFDLSYTKGNASSFLKLSQVEFNGYDFN
SYTNYSYMECESICLKLENCKGRTRKKXNEDMQQGYLLAATGFKRFSYTELKKATRGFIE
EIGRGAGGFVYKGVLDDKRVAAVKLLNEAIQGEAEFLAEVSMLGRLNHMHLIEMWGYCSE
GKHKLLVYEYMEHGSLAQNLSSNVLDWEXRFEIAVGTAKGLAYLHEECLEWVLHCDVKPQ
NILLDSNYQPKVADFGLSKLFNRGELKNSSFSRIRGTRGYIAPEWVXNLPITSKVDVYSY
GIVVLEMVTGKNPMMGGDAFDGEQRRLISWMREKVNGTSSIKLQIEEIIDSSFEGEYDVE
KVEVLLKVALHCVEEDKDDRPTMRQVVEMLLHLDXDC
Download sequence
Identical sequences MDP0000170859|PACid:22644640 MDP0000170859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]