SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000170906|PACid:22660359 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000170906|PACid:22660359
Domain Number 1 Region: 405-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-79
Family Protein kinases, catalytic subunit 0.000085
Further Details:      
 
Domain Number 2 Region: 293-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  MDP0000170906|PACid:22660359
Domain Number - Region: 258-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0266
Family EGF-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000170906|PACid:22660359
Sequence length 764
Sequence
MSNHEQLLXFLVIIIFYLTPKTAFGQPKSGCPGTCGSQSIPYPFGTXPGCYLDESFLISC
NNTSNGQKALFFPKSNVTILGISLVDHEIRVSSSISYDCYEYDNSGHLSXSSNRVSSMLT
FSKFPISSSRNRFTAVGCDTXGVIXSSKGRXYTTGCVSLCTKFEDVENGTCSGXGCCQIP
IPEDVIDYATATASLXNHSDVRGFNPCGYAFVVEEDAFNFSSLDLGNFQNRESVPVVVDW
AVGNQTCQXAKXSATYACLANNSECYESNNGXGYICKCNKGYQGNPYLLDGCQDINECEV
SNPCSSTATCNNILGSVNCLCPKGHDGDGMRNGEGCSPIDKRSTQSLKLAIALGICIGML
ALLVGGFWIYWGTKRRKYIQLREKFFQQNGGILLQQQLSCHXGSVETAKIFTAEELKNAT
NNYDESRVLGQGGYGTVYRGLLSDNKVIAIKKSKICDQSQIEQFINEVIVLSQVNHRNVV
KLLGCCLETEVPLLVYEFITNGTLSDHIHDNGQNYSLLPWEMRLKIAAETAGALAYLHSA
TSMPIIHRDVKTTNILLDDNYIAKVADFGASRLIPIDQTQLTTLVQGTLGYLDPEYFHSS
QLTEKSDVYSFGVVLAELLTGKKALSFDRPESERNLAMYFVSSMKEDRLIEILDDHVNVD
EEIIIKQIREVAILTKRCLKVKGDDRPTMKEVTAELDGLISLGKHPWGRDGFGFEETEYL
LNPNSERYNGDGDEPGGNCSTSNTSYAGFDSMKNHIIMPHDDGR
Download sequence
Identical sequences MDP0000170906 XP_008389950.1.92800 MDP0000170906|PACid:22660359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]