SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000173548|PACid:22633263 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000173548|PACid:22633263
Domain Number 1 Region: 74-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-28
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 
Domain Number 2 Region: 435-520
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000136
Family Protein kinases, catalytic subunit 0.0045
Further Details:      
 
Weak hits

Sequence:  MDP0000173548|PACid:22633263
Domain Number - Region: 344-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000133
Family Anti-platelet protein 0.093
Further Details:      
 
Domain Number - Region: 526-587
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00423
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000173548|PACid:22633263
Sequence length 631
Sequence
MGGLCFSFMISANLFFLSSTISFAVDGFTPSQCVLDGTTLVSSDGSFELGFFSPGSSKNR
YLGIWFKNVPVRTVVWVANRCNPINDTSGVLMINSXGNLVLLSQNSSVVWSTSLVKQAQN
ATVELLDSGNLVLRDAKDGNSGTYLWQSFDYPSDTLLPGMKVGWDLRTGLKRHLSAWKNS
DDPCPGDFTYGIEMQLQAYPEAYILNGSTKFFRTSAWNELTICGSPEHPSPRYSFNFVYN
XDEVXVTYKPKIESILSRVXLNQTTSTCARFQWKVGXQAWQDFSSRPTESCDYYGFCGAN
GNCTSEDPVCKCIQGFSPKSQEKWNLADWSLGCVRNKPLSCHEGDKDEFLKFDGFKLPDT
TNSWVDKSMNLKECRDKCLKNCSCTAYTSSDIGGGSGGCTIWFGDLIDIKQAIANRNPVT
EIRERNEDNEGAPRGDMELPLFDLXTVAXATDXFSSNKKLGEGGFGPVYKGTLAXGQEIA
VKRLSRSSSQGLNEFMNEVILIAKLQHRNLMKREENCSIGLNVSTLYVALLELWRLWNEX
KPLELIDTCLGSSGTISEVLRCINIGLLCAQHHPDDRPSMADVVIMLGSQTALARPKQPG
FFIERGTPEXGSNSGNQSRSTNELSISLLEA
Download sequence
Identical sequences MDP0000173548 MDP0000173548|PACid:22633263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]