SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000173666|PACid:22649255 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000173666|PACid:22649255
Domain Number 1 Region: 14-322,443-480
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.86e-45
Family FAD-linked reductases, N-terminal domain 0.000000156
Further Details:      
 
Domain Number 2 Region: 308-427
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.94e-25
Family L-aminoacid/polyamine oxidase 0.00000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000173666|PACid:22649255
Sequence length 491
Sequence
MSSPTKQDQQSSVKRVAVVGAGVSGLAAAYKLKSHGFDVAVFEAEGRAGGKLRSVSRDGL
VWDEGANTMTESETEVQTLLDNLGLREKQQFPISQTKRYIVRNGMPVLLPTNPIALITSN
FLSAQSKLXIILEPYXWKKKGVSDDDTQESVGGFFQRHFGXEMRHSFPDLWNMEKRFGSV
ISGAIKSKXSAKKEKSGQTKGSVEKGKRQRGSFSFHGGMQTLTDTLCNQLGKDELKLNSX
VLSLSYSHDGKSAFENWSVSSAAKDDKHSQSLSVDAVVMTAPLCNXKEMNITKRGTLFPL
DFFPEVTYVPVSVIITTFKKEDVKRPLEGFGVLVPSKEQKNGLKTLGNAWHGPVTXSTLF
SSMMFPDRAPSGLHLYTTFVGGSQNKELAKASTDELKKIVTSDIRHWLGAEGEPTSVNHY
HWSKACPLYGHNYDSVIEAIEKMEKNLPGFFYAGNHRGGLSVDNAIASGCKAAELVIAYL
ESPPDEKTRQE
Download sequence
Identical sequences MDP0000173666|PACid:22649255 MDP0000173666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]