SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000174381|PACid:22634492 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000174381|PACid:22634492
Domain Number 1 Region: 66-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.37e-22
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Domain Number 2 Region: 177-291
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000114
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000174381|PACid:22634492
Sequence length 567
Sequence
MATAFSVRMLXFXSLFLLPISVFSQNNGRVAVGSSLTATTSNSXSWLSPSGDFAFGFLPL
GGNDLFLLSIWYAKIPDKTVVWHAYEDNNPIVAPEGSTLNLDASSGLVLNNPQGGEIWKS
ATFGVVANGVMNDTGNFVLQDKNSGSLWETFNNPTDTILPGQTIERNGKLSSKQSESNYA
KGRFQLRLQDDGNLVLNTINLPTDFANEPYFATDTTAGTVEGSEGKQLVFNNSGDLFVLR
ENGGRFILTTAKGVSARENYLRATLDFDGIFALYAHPKTFTGNASWSSPLWYQPVDICQT
LLEGAGVGVCGYNSICKLKPDNRPTCECPKGFTFLDPKDLYRGCKPDFIQGCKEDELASP
RQDLYDVEVLINTDWPTSDYVQLKPFTADKCNESCFHDCLCAVAVFRSETCWKKKLPLSN
GRVDVXLNSQTFIKVRKDNMLENQFYLFIYAYSDFQPNITXQFPPMPISXDKEKSQTSVI
RVESLLLGTSTFVNVVLSAALCLGFGLAFSYEELQEATNGFTEELGKGVFGVVSKGDANW
FWCRSGGEEAKLCYARCRGVQNRTECN
Download sequence
Identical sequences MDP0000174381|PACid:22634492 MDP0000174381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]