SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000175489|PACid:22668252 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000175489|PACid:22668252
Domain Number 1 Region: 152-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-34
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 
Domain Number 2 Region: 16-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000175489|PACid:22668252
Sequence length 351
Sequence
MTLKIICSQSSHQLATDIDECKAPDYCGNGTCINTPGGHSCLCPIGYKYGDLDKKTCIKD
NGRAKLSLLLIIALGASGGFLLLLSGSWIYWGMQRRKFLKLKEKYFKENGGLLLQQKIAS
QGGSVETTKIFTAKXLEKATNNYHEXGILALMQIIHRDVKLTNILLDENYTAKVSDFGAS
RLIPLDQAQLATLVQGTIGYLDPEYFHTSQLTDKSDVYSFGVVLMELLTSKXALDSHRPE
GEKNLARFFLCLMEEDRLNEILDDDILNERNIXTXKXVANLAKRCVRLKGEDXPTMKEVA
MELEGMRITEKHXWGKAEICSEETECLLGPGNSDAYPMDVRAGSSXGTTIG
Download sequence
Identical sequences MDP0000175489 MDP0000175489|PACid:22668252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]