SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000175501|PACid:22620617 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000175501|PACid:22620617
Domain Number 1 Region: 8-86,114-134
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-28
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000175501|PACid:22620617
Sequence length 315
Sequence
MGLRWSESLFRCVWEANRGNPVCENATLTFGTNGNLVLAHANGKVAWQTNTANKGVVGFK
LLPNGNMVLHNSKGKCIWQSFDYPTNTLLVGQSLRAGVVSKLVSRASKKENKDGPYSLVM
EPKGLALYYKSSNYPKPQLYFSFSQRIPIQMNSLILVTLNSAPETDEGHAYDLTLEYQEA
NSSSSETFFLGRPKYNSTSTLLGLGIDGNVKLYTYNDKVDTGAWEVTFSLFDRDNSIWET
ECQLPERCGTFGLCEDSQCVACPSSKGLLGWGKSCALEKLTSCDAKSFRYYKVEGIDHFS
SKYTSGAAVKXKRLC
Download sequence
Identical sequences MDP0000175501|PACid:22620617 MDP0000175501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]