SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000177195|PACid:22671128 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000177195|PACid:22671128
Domain Number 1 Region: 119-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.9e-22
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000177195|PACid:22671128
Sequence length 226
Sequence
MYDCNAFDTCIKEGATTLMELLWHVQFAXYKFVIEKLXGEEIQLLSVRHVSEKLEILIMN
VSLLLLSRHHCAEVYEISPAQPPSEGQTLVSPRHVFELGFFSPNNNSGNNKEKPIAASDT
LASLRISSKGXLELVDGKQNPLWSTNISVLSNGSAASLLDTGNFVVKDDDVGAEPLWQSF
DYPSDTLLPSMLLGFNSKSGETNFLTSWKSESDPSTGMFMVGLTPQ
Download sequence
Identical sequences MDP0000177195 MDP0000177195|PACid:22671128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]