SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000178012|PACid:22624908 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000178012|PACid:22624908
Domain Number 1 Region: 354-585
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-60
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 93-201
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.02e-25
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  MDP0000178012|PACid:22624908
Domain Number - Region: 304-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0629
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000178012|PACid:22624908
Sequence length 630
Sequence
MTDNIQCFPMKFMKNPSNALAKMCLLLFYSSLLLMVAAVISTADDATSTFQSIRDGETVV
STGGTFELGFYYPDASNRRYVAIWYKQISVTTIVWVANRDKPLADMSGVLKVTNPGILVL
NHNMSTIWSSNTSRTAQNPVARLLDSGNLVVIDXSDDDSENFLWQGFDYPGDTFLPGMKI
GRNTVTGFNWHLRSWKSPQDPSQGNRTSQLGPKGYAELFVREGSVIKYRXGPWNGVGFSG
SPQFNPNPIFTYXFVSEPDEMYYSYKLHNXSIFSRVVLTSDGLVQRYTWIDRTXGWVLYQ
SAKIDDCVNYALCGVHGACNIEESPVCSCLKGFTPKFPKEWDLVDWSHGCGTMXDGQXIA
VKRLSKNSRQGLNEFKNEVTHIAKLQHRNLVKLLGCCIQEDEMILIYEFMPNKSLDFFIF
ARGLLYLHQDSRLRVIHRDLKASNILLGSEFNPKISDFGLARSFGGIETKAETKKVVGTY
GYMSPEYAIDGFYSIKSDVYSFGVLVLEIVSGSRNRGFSHPDHKLNLLGHAWMLHTEGRP
LELLDASIEDSVTLHEVVRMIHVGLLCVQRNPEDXPSMSAAVLMLGSEGALPPPLKPGFY
SERDMSELEVGHSSKACSANEVTISLVEAR
Download sequence
Identical sequences MDP0000178012 MDP0000178012|PACid:22624908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]