SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000181487|PACid:22646583 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000181487|PACid:22646583
Domain Number 1 Region: 78-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-26
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 
Weak hits

Sequence:  MDP0000181487|PACid:22646583
Domain Number - Region: 350-392
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Anti-platelet protein 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000181487|PACid:22646583
Sequence length 472
Sequence
MGGFGFLLIVSTNLLFLLYMSTISFAVDSIGPSQSILDGRTLVSKDGSFELGFFSPGSSK
NRYLGIWYNYKNIPVQTVVWVANRCNPITDLSGVLMINNTGYLVVLGQNKTVFWSTSSVR
HAESARVQLLDSGNLVLTDGKDGNSGTYLWQSFDYPSDTLLPGMKLGWDLRTGLKRRISA
WKNAEDPCPGNFTYGIEMDLQAYPQAFVRNSTSKIYRAIPLNGLTFCGASEKHSTRYSFN
FVYNDSEVYYMYNPTIKSITSRIVLNQTTSSCARFHWKKESQAWTVHSSRPRDLCDRYSF
CGANSNCLIGQSPVCQCLKGFKPKSQEKWNLTDWSLGCVRNEPLSCQGRDKDGFVKFVGL
KLPDTTHSWVDKTINLKECTAKCLENCSCTAYRSSDIGGRTGCTIWFGDLIDIAQVSAGG
QEIFIRMPASELEKNDGKVKTAVIVAAVVVVVFSGLLLVGCYIRRSRKKFEX
Download sequence
Identical sequences MDP0000181487|PACid:22646583 MDP0000181487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]