SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000182943|PACid:22664800 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000182943|PACid:22664800
Domain Number 1 Region: 236-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-70
Family Protein kinases, catalytic subunit 0.0000883
Further Details:      
 
Domain Number 2 Region: 78-161,193-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.23e-25
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000182943|PACid:22664800
Sequence length 753
Sequence
MNTKPNSKFVFSVILLCAFLESQVSLAADTINENQSLSGDQTIVSAGGIFELGFFKPGQL
SNYYIGIWYSKQVVSEMTVVWVANREIPISDRFSSVLSILDGNLVLLNESKTPVWSTNLN
TTTTSGSVQAVLLDSGNLVLIAGSSNNTSEPLWQSFDHPTHXLLPGGKLGFNKITNHTQX
LTSWKNLEDPAPGLXSLELAPDESNSYILLWNRSRQYWTSGPWNESSHTFNVVPEANKLG
EGGFGPVYKGILSENQEVAIKRLSKKSGQGHEEFMNELKLIAKLQHTNLVRLLGCCLEDE
EMILVYEYMPNRSLDKLLFEGIAQGVLYIHKYSRLKIIHRDLKASNILLDGALNPKISDF
GMARIFGINQTEANTNRAVGTYGYMSPEYVRYGYFSEKLDVFSFGVLLLEIVSGKKNAAF
YCFEHSPTLAGWLDEALRCIHAGFLCVQEAPADRPTMSLVIRMLQGNESTSLPPSKEPAF
STHGNSSLFRSSPTHTSFSHNAVTMSLPKAAQSLFFSIFFSIFFPCPAQSLIFSSDHLRA
FASLLLMQWQIHQRFFICLTTHVSYPLSSTPMINLLQNLEKRMEFRSMRESEGVSLWSMV
GRLGLTVGEGSGDGVHDWRKEVGRGWDGNHGIQQNHMAWQGKKMEKKRGVWSHEYPNHWP
SSQMTVSSTFLLGMGDVERRKRNGGFLCVQEAPADRPTMSSIIRMMQGNESTSLPPSKEP
AFSTHRNFSHVHSSETPTIFSQNTVTMSLPEGR
Download sequence
Identical sequences MDP0000182943|PACid:22664800 MDP0000182943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]