SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000183207|PACid:22681252 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000183207|PACid:22681252
Domain Number 1 Region: 76-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-22
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Domain Number 2 Region: 489-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000534
Family Protein kinases, catalytic subunit 0.0069
Further Details:      
 
Weak hits

Sequence:  MDP0000183207|PACid:22681252
Domain Number - Region: 361-402
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Hairpin loop containing domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000183207|PACid:22681252
Sequence length 548
Sequence
MEMXWLLVCLVTLPFLFFTMPSCASQAXLAPGQSVGPNQTMISPAGNFALGFFSPENSTK
HFLGICYSRMPKAPVVVWVANRESPLDSPGVFMFRGDGKLVVLDSIMYGKVIWSSDVLLS
ASAVNATKAVLMNTGDLQVMSGEDILWRSFDHPSDTLLPGQRLSLNKITGQQVRLTSWAT
LADPKPGIFSVGIDPKVPRQLITWKGNATXWXSSVYFSKDVNTYFRNQSGGFFYIAYSFD
ADGIYFTFGASDNSIKXRAVLSPSGKLNLLXWIDENXTWIEEWAEPTNKCDFYARCGPYG
ACXKTGDPFSSQCKCLKGFRTQFKKQWXMEDWPGGCVREKALXCDKGEVFSMFEXMKLPD
DAIIFGNRNMSECESECLQNCSCTAYAYSKVXEKGGLGCLTWFGNLTDLVENHRFGQTMY
IXVHRSDQGGKGHIQQLAIAIVSAIAGSLTIIYGFFLWKKTLRNGGCVGGSMSEVVRNVS
AGGGRNETELPFFSLRSILAATNNFSESNKLGEGGFGPVYKGILTENEVAIKRLSRKSGQ
GHQEFMNE
Download sequence
Identical sequences MDP0000183207|PACid:22681252 MDP0000183207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]