SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000186156|PACid:22670288 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000186156|PACid:22670288
Domain Number 1 Region: 521-813
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 137-246
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.64e-28
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Domain Number 3 Region: 8-66
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000484
Family alpha-D-mannose-specific plant lectins 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000186156|PACid:22670288
Sequence length 1054
Sequence
MVQEDTSYDVVCVANRLFAVLKFTNPEILVLVNQNNTVWSSNTSRPTQNPAARLFDSGNV
VIHGHTVTLVLRCMNTEPSGYALFSAADDATSTFQSIADGETIVSDGGTFELGFFSPGAL
KNRYVGIWYKKISVTTIVWVANRDTPVTDSSGVLKVTNPGLLVLLSHNMSTVWSSNTSRT
AQNPVARLLDSGNLVVIDGSDVDPENYLWQSFDYPGDTFLPGAKLGRNTVTGFNWHFRSW
KSPQDPSHGNYTYQLGPKGYAEKFVREGSVIKFRSGPWTGVHFQFSGTPQLNTNPIYTYS
LVSEPDEIYYSYKLHNNSILSRVVLTSDGIVRRYTWIDRTKGWLLQLIAQIDNCDNYALC
GVYGACNIEKAPVCSCLKGFKPKYPKEWDLVDWSNGCVRNAPLNCSGDVFIQYSGIKLPS
TEQSWHNRSMNLKECEMVCRKNCSCTAYNKFGYPGMEEADHEDDTKINAQYSESNVKKMR
IIVTSIVLSTGLLILGLALLYVWKKKCKKDGKLRSNQKEDLELPLFDLSDVVCATSDFSN
HNKLGEGGFGSVFKGTLKDGQEIAVKRLSKHSRQGLNEFKNEVTHIAKLQHRNLVKLLGC
CIQEDEMMLIYEFMPNKSLDFFIFDQRKSILLDWPKRFDIINGIARGLLYLHQDSRLRVI
HRDLKGGNILLDGEFNAKISDFGLARSFGGNETSAKTKKVVGTYGYMSPEYAIDGCYSIK
SDVYSFGVMVLEIVNGKRNRGFSHPGHNLNLLGHAWNLYTEGMSNELLDTSVGDSSNQHE
VLRSIHVGLLCVQRNPEDRPSMLAAVLMLSGESALPQPQKPGFYSERDLDDNNVDPCANK
GNPYGIRCKEKSVRKGFLSIWGLLIKITIHQNMLLASAISLKTLNLANIPILTGGSNYKK
WRREIGLLLTINEYDIAIDTPRPVITDQIRGGIKRHELAAEYLSAIEKKFKESEKAEISQ
HMSFLTTYKIDNAGSIRDHIMKMTDAAEKLNSIEVNIGEKQLVFMILHALPNKYSQLKVS
YNTQDKSWDVDELIAQCVQEETRHRQEKARILKL
Download sequence
Identical sequences MDP0000186156|PACid:22670288 MDP0000186156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]