SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000186304|PACid:22654617 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000186304|PACid:22654617
Domain Number 1 Region: 129-379
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-66
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 16-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000019
Family EGF-type module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000186304|PACid:22654617
Sequence length 448
Sequence
MTLKIICSQSSHQLATDIDECKAPDYCGNGTCINTPGGHSCLCPIGYKYGDLDKKTCIKD
NGRAKLSLLLIIALGMHMCSGGFMLLLSGSSWIYWGMQRRKFLKLKEKYFKENGGLLLQQ
KIASQGGSVETTKIFTAEELEKATNNYHESRILGEGGYGIVYKGILAADNNKVVAIKKSK
IGVPTQKEQFVNELIVLSQINHRNVVRLLGCCLESEVPLLVYEFVTHGTLFEHIHGKKRK
GSPFSLELRLKIAAETAGALAYLHSSALMQIIHRDVKATNILLDENYTAKVSDFGASRLI
PLDQAQLATLVQGTFGYLDPEYFLTNQLTDKSDEDRLNQILDDAIINERNIETLKTMANL
AKRCVRLKGEDRPTMKEVAMELEGMRITEKHAWGKAEIFSEETEYLLGTPNSDAYPVAFR
ADCGPSIGTASEYDSMQIQMLIPYDDGR
Download sequence
Identical sequences MDP0000186304|PACid:22654617 MDP0000186304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]